DPCstruct | MC41624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 368 ± 72 aa |
| Standard deviation of domain lengths | 72.28 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 90.09 |
| Assigned Pfam label(s) | PF11965- PF02514 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G9ZA01 | 39-414 | ADIILLHPSNEAHWDEIIEGLDKEVPTISFGHDSSYWSLSNVPLDVVATVNAYHAYGEAENITNMVRYIGKEVLGLDYKYENPKESL… |
| A0A5C7K7K7 | 46-459 | EAARQHLAHHPRDRILLRTPAQIQAATDRQLRQWLDADAVLAVSAFGDPARRLIDAIPASRASTVLAISGEQRLNLLSRSRAGALAS… |
| A0A6V0A4L5 | 75-555 | None |
| A0A7W7A4Z3 | 1-282 | None |
| A0A2W5T0R2 | 1-299 | None |
| H8GWP8 | 172-588 | None |
| A0A0Q3NW02 | 10-330 | None |
| A0A843DZZ9 | 2-287 | None |
| A0A2X2VWC1 | 5-367 | None |
| A0A3R6L5B0 | 4-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.