DPCstruct | MC41623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 20.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G9Z272 | 1-99 | MGKKVSLKDEKILDSWSTLIEDAQKKNQEIFNNTTASIKESQAPGITIESVRVRPSWLQGFFGNERDYLMMTNLGLRDYRMYIGARD… |
| A0A7C3H1F5 | 8-103 | RPYDGWDDTIEGQGNKAEAVRRAFAEEMKRRAPPNLKTYRGTLSTGGVTGKRRPYYLVRNYAGALVAIYLASFGRDLYLAWDLFVRK… |
| A0A284VNQ7 | 205-310 | None |
| A0A4Q1CFB6 | 61-146 | None |
| A0A7C1IG15 | 9-98 | None |
| A0A6I7LRM3 | 94-187 | None |
| A0A7C4M5G5 | 5-124 | None |
| A0A522E3E6 | 39-157 | None |
| A0A7C6RHL0 | 345-447 | None |
| A0A1Q7VGE0 | 326-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.