DPCstruct | MC41620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 147 ± 24 aa |
| Standard deviation of domain lengths | 24.30 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P1VUV8 | 126-252 | RARNKLIIFDDPMNSNDDTMQYLIIEELQKLMRELLKNNKDDKFILMTHNVHFYINVKYDFDKDDDYKKKRNFIRLVSDTKKTKINY… |
| Q936G6 | 25-156 | NFIYGSHESTSVTSNKIAIIDDPISSLDSNVLFIVSTLVKNLINDCRNNKNRIQQVFNLTHNIYFHKEITFLGSRERFSLNEVMYGI… |
| A0A6N2ZBS2 | 527-646 | None |
| A0A2J9EX52 | 290-409 | None |
| A0A847AFV0 | 2-133 | None |
| A0A1V1V8T8 | 427-603 | None |
| A0A3A9GJN9 | 1-181 | None |
| A0A5E6XQF4 | 132-307 | None |
| A0A2S5AJ29 | 54-177 | None |
| A0A417YYN1 | 63-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.