DPCstruct | MC4162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 60 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 87.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251VMY7 | 1-58 | MYNSISVVIFHFSWKMQSAVWGSISDQVVVTHITGGNFAQSSITINGWLRYFLWAQAS |
| M1WY86 | 130-187 | MYNSLSIVIFHFSWKMQSDIWGTIDTAGNVSHITGGNFAQSAITINGWLRDFLWAQST |
| A0A2G3B988 | 103-169 | None |
| A0A287TXV6 | 121-178 | None |
| A0A4D6M3U4 | 900-963 | None |
| A0A6A5PKA9 | 575-631 | None |
| A0A7J7L6X1 | 433-498 | None |
| A0A5J6YDD8 | 77-136 | None |
| A0A2U1PTW1 | 212-269 | None |
| B9RX98 | 260-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.