DPCstruct | MC4161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 3.45 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251VGP5 | 1-56 | MAKNMGVKMHFRKHHVVIDNGIFQLTLTNPGGYVTGVKYNNIDNLLESQNDESDRG |
| A0A1S4CSV3 | 1-57 | MTAPGVQLHLPDDHHVVMDNGILQVTLLVPDGIVTGIKYNGVDNLLEILNDDETNRG |
| B8B9E3 | 8-66 | None |
| A0A6A3D055 | 24-83 | None |
| A0A6P5TYR1 | 1-51 | None |
| M7YJH1 | 3-53 | None |
| A0A540KC47 | 1-55 | None |
| A0A3Q7Y880 | 1-51 | None |
| A0A835BRN6 | 584-632 | None |
| A0A6I9QDX9 | 1-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.