DPCstruct | MC41608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 284 ± 30 aa |
| Standard deviation of domain lengths | 30.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3TDS2 | 20-295 | AALLSGTEIVRVHEELVHADVLVVYLSIVAMTSSVIQERIPPSFAIFLFEIIHKHRLVFIRICPAVLREIVNYSNKVFRLEEAVVTP… |
| K3X070 | 235-532 | VVLSVYVDKMWAIVEFCTYDASDVAAIEKISIYESIARADLMSLYLCACGVIGILCRERVDPVVAMISFELGYAYRQQMLTWVPAVL… |
| A0A3R6VB48 | 374-693 | None |
| A0A397CWI8 | 82-402 | None |
| A0A485KF06 | 16-261 | None |
| H3HDQ6 | 258-549 | None |
| A0A3F2RLG0 | 82-349 | None |
| K3X069 | 106-359 | None |
| A0A1V9YHI8 | 15-318 | None |
| A0A1V9ZVX8 | 363-650 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.