DPCstruct | MC41603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.80 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z5RIS8 | 15-96 | ERFLCQPVKSVVRRAKLSLYNKVAESLGHVVLGWHPVPTDNSDLGESALETEPVIEQVLVTKISRSEVEFEQQVITFRYSCK |
| A0A0J6WGA3 | 89-160 | ADGTNTFAAGICYLPQDPSARDEACAAIAAIAAEEGLEILGWRELPVDPEGAEVGQTALGCMPHMAQLFVAA |
| A0A2X2E8K5 | 79-149 | None |
| A9WR51 | 128-202 | None |
| A0A6G3V7J7 | 4-71 | None |
| W4QIA8 | 99-169 | None |
| A0A0D8XD42 | 86-161 | None |
| A0A5E4PR16 | 88-154 | None |
| A0A182TIG5 | 11-78 | None |
| A0A0Q9XCL6 | 153-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.