DPCstruct | MC41596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 776 |
|---|---|
| Mean domain length (aa) | 150 ± 34 aa |
| Standard deviation of domain lengths | 34.37 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.97 |
| Pfam Score | 98.72 |
| Assigned Pfam label(s) | PF12955- PF11938- CL0278- CL0015- CL0149 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0QSM2 | 87-232 | DVKTQNDEKYYYFAFGSNMNKNRMIERDCQFVNRQLGILPGYKLDFSKRSTKKEGTSYANIREKEGSTVEGALYELKDHDQILKLDK… |
| A0A1H2Y9N2 | 41-173 | RERQAVLAYGSNACPSKITWLREELGLQGPVVVVRARSVGLAAVWASGLRVRDGQRPTTLVAMPGVVEWHAVWFATPEQIEVLDVCE… |
| A0A6G3HJY6 | 41-150 | None |
| A0A842RVC8 | 25-141 | None |
| A0A523DEA2 | 2-146 | None |
| A0A2E3IPY0 | 80-264 | None |
| L0KXE2 | 1-114 | None |
| A0A6A4JWR2 | 2-177 | None |
| A0A7I4DIT8 | 83-281 | None |
| N4VFD4 | 553-716 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.