DPCstruct | MC41592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 602 |
|---|---|
| Mean domain length (aa) | 168 ± 37 aa |
| Standard deviation of domain lengths | 37.14 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.70 |
| Pfam Score | 95.49 |
| Assigned Pfam label(s) | CL0137- PF13966- PF00689- PF00122- CL0197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0QD05 | 25-186 | HPKILFEIRDQENNKQFEVLKVFEFESHLQRMSVIVYDVKGSKYYIYTKGAYEVIEKITGKNQNLQFSNNLLDSLSLQGLRVLATSY… |
| A0A453BA03 | 5-128 | YEILDILEFTSDRKRMSIVISDSQSGKIFLLSKGADEAILPLAYCGQQIKTFVDAVDKYAQLGLRTLCLGWRELSLEEYLEWSRLFK… |
| A0A6A6LLM8 | 59-269 | None |
| A0A6I9YMN3 | 136-319 | None |
| A0A444WPD7 | 137-237 | None |
| A0A7C3CQL3 | 584-717 | None |
| A0A2N9I3T5 | 64-226 | None |
| A0A1Y2HCR9 | 619-838 | None |
| A0A820DZM5 | 144-381 | None |
| A0A0D8XA36 | 221-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.