DPCstruct | MC41590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 102 ± 4 aa |
| Standard deviation of domain lengths | 3.92 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I6NJV3 | 1-98 | MILLAGTTEQAERGDQLEFLLDVAWTDHAELSVSAAVSVACWCDTGHATHDVDALHLIINGETSLSQAFQAGVDRLVGWLADPRDAD… |
| A0A1T3NV60 | 58-159 | EPEPEPSPHILGTALLLYEADGDWLELGLDVWQLDGPFVSVTATVEVACWCDTDHNMHAVQRAEWPASTAQAFLEAFHTAALSVIRR… |
| A0A2M9LD10 | 1-109 | None |
| A0A4R6JBS3 | 29-132 | None |
| A0A2U8V0W1 | 60-156 | None |
| A0A3N1A2S6 | 26-124 | None |
| A0A100Y2A9 | 100-199 | None |
| A0A101JKJ5 | 51-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.