DPCstruct | MC4159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 129 ± 7 aa |
| Standard deviation of domain lengths | 6.57 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 60.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251VCV0 | 1-144 | MECSRKPTTVYCGFGSSFGLAVYHAYSGNSFKALEHYLGCGFWQKAHSTFITSVAHSLFMSGKQSEILRLATSMEDHKSEIENWDLG… |
| A0A2K2BSG6 | 1-132 | MPCMQAVYFRCHGDLPKALEHYLECANWQKAHSIFVTSVAHKLFSSADHSEIRRLAIAMEDHKSEIENWDLGAGIYVSFYSIRSSLP… |
| A0A151RZZ1 | 570-688 | None |
| A0A3L6FS64 | 56-182 | None |
| A0A0P0VTQ6 | 456-582 | None |
| A0A1R3G4B3 | 634-761 | None |
| A0A3P6A723 | 349-476 | None |
| A0A803P097 | 864-991 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.