DPCstruct | MC41585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 153 ± 14 aa |
| Standard deviation of domain lengths | 13.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I6P8N1 | 12-160 | GGGPGGGMPPGGGMPPGGGGPGGGGMDGASLTRLVSGEVASQIGWLYPLALFGMIAVLVLLRRRPRHDAQRADFLLWAGTLLITAGV… |
| A0A0R1YX34 | 1-156 | MGAGGGGGAFNIGTIGPLRLFQSALGPQISWLLPFAIIGLIGGLVYYRDRRKRWLHLSTEQKHLVLWASWLVPVAGFFSVASFFHPY… |
| A0A6S6XPE5 | 2-150 | None |
| A0A6B1JLM3 | 7-157 | None |
| A0A5J4KXX8 | 2-133 | None |
| A0A7W4F0Z8 | 6-152 | None |
| A0A0K2RHV7 | 1-140 | None |
| A0A2A7QYA2 | 16-151 | None |
| A0A0X8JD52 | 22-167 | None |
| A0A1Q4D6F6 | 53-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.