DPCstruct | MC4158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 257 ± 28 aa |
| Standard deviation of domain lengths | 28.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 34.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1A0Z1 | 5-267 | SDVVDKWIGMGKKEQPKHLIQFLEKVKSSPGFRGVHEFDHAKIPSLDTEEPPNCWALPIVTLTSIAIALPDIDFHLIEELIRSVYEG… |
| A0A251V4R8 | 6-261 | RTIEGFSKSVNPLIQKGAKGQPNYLIKLIREKSTQGFRGVADYNIQSSNCWRLAVVTLTTIAISLPEKEKEDVDFLLECVREGLVYV… |
| A0A3S3M6Z0 | 1-206 | None |
| A0A7N0U121 | 352-649 | None |
| A0A830CGQ5 | 24-251 | None |
| A0A2U1Q0A2 | 983-1269 | None |
| A0A6B9V515 | 212-502 | None |
| A0A4S4E031 | 413-696 | None |
| A0A2U1PXG6 | 352-631 | None |
| A0A843U771 | 239-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.