DPCstruct | MC41570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 13.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N6XQJ0 | 25-120 | ETLLSTSDSVFKLLGDEQRRHLVLYLTEQDTVTPLSRVALEITSRCNDTPYTDITPAEQERTRFRLEQEHLPRLADYDILSWSYGDD… |
| A0A161XK88 | 15-178 | PMFAAVETSRRRATLAILLDRTAATDERELARLLAATEEGTPVADVSEEDVQTNRLDLHHKQLPVLRNSGLVDWNEGTGTVTTTDHR… |
| A0A6B9F3S3 | 208-301 | None |
| V4HDE8 | 15-125 | None |
| A0A7C5ICL7 | 5-100 | None |
| A0A1I5VXJ2 | 11-122 | None |
| A0A1I5TCH2 | 11-127 | None |
| L9VYD7 | 10-127 | None |
| U1R2P4 | 29-132 | None |
| A0A6B0GPD6 | 17-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.