DPCstruct | MC4157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 272 ± 39 aa |
| Standard deviation of domain lengths | 38.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1MUI9 | 6-240 | SPEFKEFMESVKFVGFDPVKVKDSLMAIPGFTYEDMCACSYFFLSKGTNLTRILQKLNPSRKRELQGLISKYNLVSKINSPAAVTLA… |
| A0A251V349 | 1-278 | MDNNYDSLESMASLNSPSAAKKFIELDENPEFDDLDYLGFDYVKIHQAVFHAKKKHKMDSKTIAHNLHLIINIALRRGNIRDDQILK… |
| A0A4P6D8E8 | 25-325 | None |
| D7LYZ4 | 3-205 | None |
| A0A816UHX0 | 1-262 | None |
| A0A813W659 | 6-218 | None |
| A0A6A4JLU6 | 887-1173 | None |
| T1HM35 | 24-310 | None |
| T1HKV5 | 12-263 | None |
| A0A7J6ZEC0 | 97-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.