DPCstruct | MC41566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 267 ± 64 aa |
| Standard deviation of domain lengths | 64.14 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 16.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3JU41 | 37-265 | EDDLPNSRATRSAPFIGLSASPRSLLHPAEVERYIRSDCASYLQNNAERWLKNGLWYQTEFPNPKGADPSCEGLRFVYSCICRLEMR… |
| A0A0D9NIL0 | 5-176 | QSTVTQSLIRHDAKQFLLDNCGEIYQEWTSLLAKTTLPAEATSSDQRILDMLLTLDVAFNTASQRIIRLASIQLTRVLKGLKEKVKE… |
| A0A401KZB1 | 286-579 | None |
| A0A5N5WMX9 | 363-694 | None |
| A0A094AB96 | 199-408 | None |
| A0A0C3D6D0 | 277-556 | None |
| W9NGU1 | 37-359 | None |
| A0A395GJ92 | 129-411 | None |
| K2SBL1 | 11-252 | None |
| A0A2V1B4Q5 | 199-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.