DPCstruct | MC41561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 36.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U5CF59 | 1-108 | MASQTRSARLSKFLSLVVSGKRLVTTADSFVLLLESVQDQTDHAACVERIIASPPARNALHAGLRFNTKPDFLNKHTSTFIAYLMEP… |
| A0A1V6PKV3 | 1-106 | MSTNIRSERLARYLGAVLHGKQEVQDLSNFKRLIEAILDQGDPCVVVERLIASPSALNALRNGLRFNLTPVFINACTAKFIQFLNHP… |
| A0A0G4KUQ2 | 1-115 | None |
| A0A0G4KUU6 | 1-124 | None |
| W6ZCH6 | 1-115 | None |
| A0A175WBB2 | 7-109 | None |
| W6PPX9 | 1-110 | None |
| G3J6R4 | 1-111 | None |
| A0A4Z1JM92 | 3-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.