DPCstruct | MC41557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 322 |
|---|---|
| Mean domain length (aa) | 145 ± 43 aa |
| Standard deviation of domain lengths | 42.93 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9M7M9 | 12-144 | GVDYNRVTEVEVGEFKDAKAKPEVRVYFVPMPCMHCGRPACLAACPVGAITKREEDGIVLINKDKCIGCRYCAWACPYGHPQFNAEA… |
| A0A7W4B3D3 | 2-158 | TGAMHKDKRGLTLQNNDECIGCKKCMNACPYGVISFNAATPHRRWQDDSELVANGTVSPLMLLKRTGATASPNENPERGDTYPVTRP… |
| A0A2N5YJF7 | 99-218 | None |
| A0A7J3G4Y8 | 5-122 | None |
| A0A7C5L7J2 | 7-115 | None |
| A0A3D3JXF6 | 273-428 | None |
| A0A2R4ZNI7 | 59-163 | None |
| A0A1V5Z542 | 1-87 | None |
| A0A378BUI1 | 2-184 | None |
| A0A0C2MKV8 | 167-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.