DPCstruct | MC41555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 172 ± 29 aa |
| Standard deviation of domain lengths | 29.07 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5B3U5 | 7-173 | LVNFETNAYSVPTRYAGRKDAQINAYVNHIEINIDGNCVAKHERSYEKLQEIFEVDHYLDELERKPRAIQHARPVRRANLPPSYQEF… |
| A0A7X5R6X2 | 5-151 | IGRKVDREGRVRFNGQRIYYLEPKYANKKVQVKLTYNKVIFYDKELNEIAGFDRLYGDKNYTAIHWEQWLPTLSRRPNSLFHSSFTD… |
| A0A521C8C4 | 146-284 | None |
| A0A2P9I1C8 | 2-156 | None |
| A0A1K2FAS7 | 260-456 | None |
| A0A063YGW5 | 1-152 | None |
| A0A7C5NGP4 | 19-167 | None |
| V6SZ06 | 19-150 | None |
| A0A6I1L7D4 | 8-235 | None |
| A0A375CMD9 | 612-787 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.