DPCstruct | MC41553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 87 ± 15 aa |
| Standard deviation of domain lengths | 15.32 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 43.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D9TIJ6 | 209-282 | VEMLDWFSQGNYVFPIGSVGKFIDIQTGKYFFAKRTMGASHADVETLSYKDTQIMKEIFGGSWTWERRPFILEV |
| A0A0Q9N1D8 | 112-183 | GEMLPWEEASLVLPKYSSFTVVDVMSGLSFEGQRRAGSHHADVQPLTKTDSATLKSIYGGQWSWDRRAVLVK |
| A0A6B8RP06 | 299-393 | None |
| A0A0L6JSZ6 | 100-218 | None |
| A0A7X9KYX5 | 819-890 | None |
| A0A7C6FL43 | 289-361 | None |
| R7IAT7 | 547-636 | None |
| A0A101WG30 | 235-319 | None |
| A0A1H5TB69 | 55-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.