DPCstruct | MC41545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 161 ± 21 aa |
| Standard deviation of domain lengths | 20.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 16.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W6BVF9 | 34-180 | LKDRESQVLKVFGLSKMWQFVFDDKTLWRDFVDLLVAEGALAEESRSSFESVSTFVSLYALNIMHGARLKMASGKMAQLRLAASEEF… |
| A0A2N8K6K0 | 40-228 | GHTAFEKRAGLSLKAAHKTLCSLADRLVPNPDNTWQMPPDWTDKEFAVLKCVVSLIVSKPAFEPKVLTEGFLDTLKSYGLLTREEVR… |
| A0A811GWQ8 | 87-276 | None |
| A0A2E1B833 | 15-161 | None |
| A0A151KTN9 | 70-219 | None |
| A0A442HVY8 | 36-221 | None |
| F5YBB7 | 98-241 | None |
| A0A722VGM5 | 143-292 | None |
| A0A6M3M6D1 | 1-133 | None |
| A0A1B9YGQ9 | 29-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.