DPCstruct | MC41544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Standard deviation of domain lengths | 15.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 37.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565CVA9 | 143-283 | YKMRDLAEQHNGLNTLTNSDLSPYSWISIAWYPIYPIPAVNSRKELSASFLTYHSLTPCFPEKFGAGDKVNQVGKPIKPKVVLPPFA… |
| A0A835JRF0 | 22-145 | LRSCDLSPSSWISVAWYPIYRIPMGPTLQNLDACFLTYHSLSTSFQSHSIEGMHLQGSTVRELHRSDMPLKLPLPTFGLASYKFKVA… |
| A0A1D6QBS9 | 5-107 | None |
| A0A0B0NYR9 | 27-152 | None |
| A0A6J1K5Q3 | 202-332 | None |
| A0A4S8IZS5 | 36-145 | None |
| A0A7J8YGE7 | 116-250 | None |
| A0A0A9GJS6 | 90-200 | None |
| A0A0L9TXH0 | 190-325 | None |
| A0A453ESI7 | 116-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.