DPCstruct | MC41540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 129 ± 25 aa |
| Standard deviation of domain lengths | 24.76 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00829 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P0FYS4 | 25-157 | GIVHSAGVAAGAGTSALVSAWFFIMTYAIFQTGGKQYRVSRGESVDVERLDVEAGSKVVFNKVFLTAVGGKVAVGSPVISGAAVTAD… |
| A0A2K5C9B5 | 48-188 | SPPWPEIVLPDPAEETRHHAEVVRKVNELIATGQYGRLFAVVHFASHQWKVTSEDLILIGNDLDLQCGERIRLEKVLLVGADNFTLL… |
| A0A6V7X5R2 | 104-242 | None |
| A0A7S1P9N5 | 11-130 | None |
| G8R001 | 2-112 | None |
| A0A7V5PDV4 | 2-113 | None |
| Q2H655 | 574-721 | None |
| D6YSF1 | 2-114 | None |
| A0A146IN91 | 12-150 | None |
| A0A813RN70 | 299-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.