DPCstruct | MC4154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 412 ± 81 aa |
| Standard deviation of domain lengths | 81.28 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 70.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 30.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0U121 | 1-520 | MPSRDDQLAKLSSTVLICTIIGNSMPSIGVMENQEIMMNIIALGILVVTVIVNISIQLATGAIYLFWKEHIITMFLMLVLFIFLSFT… |
| A0A251UYW9 | 3-381 | SPKDAMPWVGLYICGASLVCTLAMAADAIQGIRQRNFWFPCRFFTVNAASVTLIAIAMKLSVDLTTEMPGVSDKTAKYYSIHFLFTM… |
| A0A6A2X8N4 | 31-505 | None |
| A0A804IUV0 | 11-336 | None |
| A0A6J5USN5 | 2-454 | None |
| A0A2U1Q0A2 | 620-1151 | None |
| A0A4S4E031 | 10-446 | None |
| A0A2U1PJR9 | 5-305 | None |
| A0A4D9B9N2 | 2-498 | None |
| A0A2U1NZI1 | 45-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.