DPCstruct | MC41538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 123 |
|---|---|
| Mean domain length (aa) | 109 ± 29 aa |
| Standard deviation of domain lengths | 29.10 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 89.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01196 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A381R7A7 | 6-97 | ATSLFRHERIETTTAKAKELRPYAERLITLARRGDLHARRLVARKIQDREVLGKLFDEISPRYAERPGGYTRILKLGNRKGDAAEIS… |
| A0A2H3J2E2 | 12-121 | SRSSSHRQALLRNLVTSLIKHESITTTWPKAKEAQRLAEKLITLGKRNTEHARRRAQSIFYTPHELLPKLFGPLRERYAERQGGYTR… |
| A0A7G2LW74 | 2-70 | None |
| A0A5N6PCW6 | 340-447 | None |
| A0A838G2G1 | 10-121 | None |
| A0A838UMP4 | 154-215 | None |
| A0A1F4UWS2 | 1-130 | None |
| A0A7V5PW22 | 1-49 | None |
| J9B2Q6 | 7-157 | None |
| A0A4S8IVG8 | 29-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.