DPCstruct | MC41530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 183 ± 32 aa |
| Standard deviation of domain lengths | 31.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.72 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0236- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847NI80 | 8-213 | IRLEPQIFKKFGDIFTEEQMKDIIKAKGRSGQLLELLLGLENSSKLLDFENGELKTNKCDRLGKPLETMFIMQISSIIDELLAKKPF… |
| A0A0R1QJ69 | 6-185 | TIQFDKRGYNRQSMSFPYFDFKNICEEEWEDQSGTPSAELNMMLSESTMIFCVFQYDSNGNNFFKGFKFYNIPQTDIDGPIFDCWRN… |
| A0A1Y4ART4 | 78-234 | None |
| A0A0Q4BCK3 | 100-295 | None |
| A0A087E6J4 | 89-267 | None |
| A0A4Q7DQS2 | 1-155 | None |
| A0A7Z2DEQ2 | 36-217 | None |
| A0A380K3J1 | 46-260 | None |
| A0A6G1N7H6 | 5-179 | None |
| A0A380K4B2 | 30-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.