DPCstruct | MC41528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 287 |
|---|---|
| Mean domain length (aa) | 196 ± 30 aa |
| Standard deviation of domain lengths | 29.98 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.65 |
| Pfam Score | 69.95 |
| Assigned Pfam label(s) | PF13739- PF11738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7AFM8 | 10-191 | TMRYLKPPLIDFFYPVVEGLGDSAVEQRINHQIVSQMYKLIAELQQPGLTTQVTGYYEIKANERNVLSLILSAMGEFGGAHPMTIVH… |
| A0A847NGU5 | 14-195 | VIERDYISVYYPQVQGLGNTDVENRINRRILNLVEDLINSQLDEEAIVEITGSYLVRLNKKSLLSIRFEIYSYREMAAHGLTIVKSL… |
| X6JWL6 | 494-710 | None |
| A0A5S4F236 | 104-292 | None |
| A0A316RVN1 | 156-364 | None |
| A0A0D0QRE0 | 87-231 | None |
| A0A1Q3N256 | 182-356 | None |
| A0A357NMM7 | 38-206 | None |
| A0A7U6QJP1 | 49-237 | None |
| A0A2R9T0N9 | 2-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.