DPCstruct | MC41527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 10.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847CW16 | 8-119 | PLLEDLKRAIVDYSNYEFSESNSYEDFDKLYPDLSHIGLAYTETPDGKHSIQYEVNLEEKTWTQYVDNVAIRTESFVEEDISNSQAI… |
| A0A6I3PP00 | 10-104 | AKKLISDFVEEEYGNEEVDFSDLSSIDVAYTTTDDELYDVQTKINLENFSINYFLNGNIIKTEGYGSLQELCVLALSCLSFDWLIEP… |
| A0A1S2MGD5 | 12-124 | None |
| A0A1K2CSH9 | 120-232 | None |
| R7EV70 | 268-377 | None |
| A0A396QFE4 | 888-989 | None |
| B0S477 | 5-118 | None |
| A0A847E4P6 | 105-202 | None |
| E6LRP3 | 642-753 | None |
| E1NRY6 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.