DPCstruct | MC41525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 304 ± 41 aa |
| Standard deviation of domain lengths | 40.61 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.74 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | PF01992- CL0475 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847ATT9 | 9-321 | YLFSTARVRSVEKNMLTRERAEKMIDAKTTEDALRVLDDCYYGSGDAINVDDYEILLTEEHKKTYDFITSIAPELDYFKMFLYPYDY… |
| A0A1R1MLR3 | 3-278 | LTRPLKFSYTNAMCRTIKSTLLEKSTFEQLVTATTVGDILVTIKSTPYEKFIKSALEKSMSKGLDAYFQYLYKKVTDKLSKREKEVF… |
| G1T239 | 194-526 | None |
| A0A3N9P2E4 | 51-406 | None |
| A0A524Q6P9 | 36-362 | None |
| D2MQM2 | 4-289 | None |
| A0A2N2B994 | 8-333 | None |
| B7P918 | 198-518 | None |
| S9W718 | 16-292 | None |
| A0A6G8PW20 | 11-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.