DPCstruct | MC41523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 5.08 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 33.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2NSV8 | 130-202 | FTVPLNWLMNQEPERHIVDYDVRPRPDFPYDRIYGGKKYPFRNRQMAEMFYNYGDKTIWGLTARILQHFLSVI |
| A0A7X9GXT3 | 1-75 | HIFTVPLDFFMKNEPEVYYLDLLIQNSAEFPYNLIPNGEDYKWGRGKHIVHFYHYKDYIIWGYTAKVLKNLTNII |
| A0A0C2RS57 | 66-142 | None |
| G5KGP0 | 93-166 | None |
| A0A5S9MJ21 | 1-83 | None |
| A0A3R6UZI5 | 265-339 | None |
| Q5X9D4 | 47-124 | None |
| A0A7X8W876 | 19-99 | None |
| A0A1I4BDE4 | 266-341 | None |
| A0A1G0UJH8 | 27-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.