DPCstruct | MC4152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 76 ± 7 aa |
| Standard deviation of domain lengths | 7.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V2UQ36 | 1-65 | MSITLNGHQLKSLLDFVNTDGEKDLEQLETELTIKFFEDGHSGKGYYFWMTEYPEEGSMLLDIES |
| A0A261S0E8 | 43-124 | KPGDGQVAHALTLNGHQLWDALEFLAPDRTDEQLEQAVCIHPGPARTADGFTEAAGLYCWLADYPEEGSIRLDDTAPIISSM |
| A0A7D6E4R6 | 1-69 | None |
| A0A6G8C2U3 | 8-88 | None |
| N8WRS7 | 109-184 | None |
| A0A497XH57 | 1-75 | None |
| A0A009KPD3 | 204-282 | None |
| U2FE95 | 60-142 | None |
| A0A379KD66 | 169-244 | None |
| A0A4S5CH88 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.