DPCstruct | MC41519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 121 ± 20 aa |
| Standard deviation of domain lengths | 19.82 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 27.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00460 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7ZB98 | 2-129 | TTFLGMETMRRAVSANQVALQTVGNNIANAGTPGYSRQRANMEATLGYPGLGPFGQPVMNGRIGTGVEISKIERIRDQFLDQQFRSE… |
| A0A1D2X6E4 | 1-134 | MIQNGIAGMTAASTSLMVTSTNIANASVAGYSRQQAVYDTSPTGTVYVSSIERITDDFYVSQAQDASNSLGYATAFASQSSKLETTL… |
| A0A381H6Y2 | 5-125 | None |
| A0A7G6Z3C0 | 281-407 | None |
| A0A521U0K1 | 104-236 | None |
| A0A1V1V9L3 | 2-91 | None |
| A0A418WAM9 | 3-125 | None |
| A0A6N7AJ18 | 7-86 | None |
| A0A2A4TG08 | 3-124 | None |
| A0A381I4G6 | 7-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.