DPCstruct | MC41514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 239 ± 49 aa |
| Standard deviation of domain lengths | 48.54 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 14.32 |
| Pfam Score | 52.27 |
| Assigned Pfam label(s) | PF08797- CL0167- CL0654- CL0414 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C0B7M4 | 109-308 | YPLEEVAVVLHYRKENGEISNRTVDVTSYKKTDFADSSYIYGYCHLRNEYRTFRVDRIKSLADGKTGEIIKDIKSYFIKKYESSIYY… |
| A0A6G6WUU2 | 14-267 | PDGKWSRVTQLQRVVGVQYRKRNAVEFAKLVFAAARKGNPYGLLAEREPDNPHDRNAVKIIGWGIAKSTFLGRKVPVNLHLGYLDAD… |
| R9IKC5 | 15-197 | None |
| A0A4R1TKZ3 | 34-267 | None |
| A0A6N0DXI3 | 16-241 | None |
| A0A7W0PLM9 | 2-280 | None |
| A0A1Q9TYD5 | 10-235 | None |
| A0A0F2RG97 | 28-263 | None |
| A0A5P8NLK8 | 147-364 | None |
| A0A0T5NUT3 | 240-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.