DPCstruct | MC41513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 138 ± 16 aa |
| Standard deviation of domain lengths | 15.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20245 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A522APP1 | 85-213 | WYWQSEEPWAWACYHYGYWVYDPDYGWIWIPGVEWAPAWVTWRCGGGYIGWAPLAPVHVSVEPQFVFVSTGRFQSPIHPSTVVIQNN… |
| A0A6G6WN96 | 7-134 | WPLGFFQDIGWYWIPGRRWAPAWVSWRRSRDYVVWAPLPPRFDDDFSIEITVRDIPNDYWVAVPSRSFLERDLSASIIDDDHERFRA… |
| A0A3N5LBA7 | 128-249 | None |
| A0A3N5KWD7 | 160-290 | None |
| A0A2V2S1Q4 | 200-334 | None |
| A0A7W1U6G9 | 94-256 | None |
| A0A2A2RAH5 | 110-254 | None |
| A0A1F7RXX0 | 83-231 | None |
| A0A524N225 | 218-369 | None |
| B4D5N4 | 338-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.