DPCstruct | MC41510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 12.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A432WFE0 | 1-82 | MLTKTKWALLAATTALTLSACGGFDYGDDSGLWTMDRECDDPRFVDVPGTPGGMASSLDENDTRRDATDCEGLHKAGWIEPR |
| A0A848YIC8 | 223-276 | LDFGDNSGIYANDGTCDDNRFTGEGRSILMTDSHVRRDSADCIAAYREGTINRP |
| A0A0N4Z8Y6 | 726-826 | None |
| A0A399RIN1 | 472-555 | None |
| A0A4T3F677 | 5-93 | None |
| A0A6M1SJ80 | 7-84 | None |
| A0A7G5LIH2 | 2-69 | None |
| A0A844Z1D5 | 1-95 | None |
| A0A7C5C9L2 | 2-57 | None |
| A0A844ZR70 | 30-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.