DPCstruct | MC4151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 6.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 49.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377CVR4 | 60-155 | LSNRDSVFETLEAQEMLWLLQAVMTPERENTLRSALATSMMGLNALDIETLNNDEHAWDAVVEEFDGYRQIWRKRGVMPMLRALMSA… |
| A0A7H4M6X0 | 2-78 | LQAVLAPERENTLRSALATAMFGLNAQDIENLNQSERAWDELVEEFSGYRQVWRQRGVMPMLRALMTARRIAENLLA |
| A0A376TTD8 | 2-84 | None |
| A0A4P0YFA8 | 151-246 | None |
| A0A6M5Z8G2 | 98-180 | None |
| A0A1V1P8P4 | 407-494 | None |
| A0A4U9V107 | 29-111 | None |
| A0A2S7XPU9 | 78-172 | None |
| A4NZ46 | 165-259 | None |
| A0A377BYV4 | 261-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.