DPCstruct | MC41507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 270 ± 36 aa |
| Standard deviation of domain lengths | 36.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19484 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6NCK6 | 43-317 | LTALLLKARRKLLMLLTSVIILVAVYQGPVYALCGVQKGTALREMLSLPLQQMAWVYNNDDLTEKQRKEMQSFVPDEGWKNYTPFIS… |
| A0A7U9T6J9 | 272-526 | VLLIMAYKNWRREILLLVFSAIVIAEGMDMVLKPAGVEKLFQESVGMQLQQVAASVNKGPELTAEQEDYLYQLFPEELWGIYAPCCV… |
| A0A1E9A1A8 | 340-607 | None |
| A0A1Q6T9J6 | 2-216 | None |
| A0A1G5CBQ5 | 627-919 | None |
| A0A1C5Q250 | 408-776 | None |
| A0A5J5E365 | 341-642 | None |
| A0A087CMD5 | 325-578 | None |
| A0A416IX59 | 17-270 | None |
| A0A349MTA5 | 2-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.