DPCstruct | MC41504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 132 ± 11 aa |
| Standard deviation of domain lengths | 11.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3MP29 | 339-478 | ADAATGKLTEAQAKASSFATRMDQAEKILSTVQGEGLSAMNRVAGAIPMAGNYLQSPQYQRYKQAASAFITAMLRQESGAAVNPAEF… |
| A0A503X9T7 | 386-515 | GGQKLTEGQSKDLVFYTRGIDAESLLSGMDDQLAKFGQQNAGLLPLGLGNYVRTPEFKQAKQAADSFLTAILRKDTGAAITDKEFDQ… |
| A0A031JNG9 | 124-262 | None |
| A0A4V1ZIT2 | 537-686 | None |
| A0A4V0WTZ3 | 243-364 | None |
| A0A2U2DW83 | 512-629 | None |
| A0A4S1FPQ1 | 264-401 | None |
| A0A7C1VKK8 | 314-440 | None |
| A0A0Q7VTP5 | 573-713 | None |
| A0A2D6LSA3 | 152-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.