DPCstruct | MC4150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 17.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090T812 | 30-159 | LHANNKHQGRYDFKCLIEAEPELAEHVVRNPHGDMSIAFSNPESVKVLNRALLKAYYGLSHWDIPDGYLCPPIPGRADYIHRLNEWL… |
| A0A7H4LWS2 | 8-124 | LHPRNRHQQRYDLPALCQAHPELQGFITLNPVGEQTIDFANPLAVKALNKALLAHFYAVKHWDIPDGFLCPPVPGRADYIHHLADLL… |
| A0A6H5I808 | 20-121 | None |
| A0A812W0Z2 | 1-128 | None |
| Q5DGC0 | 7-123 | None |
| A0A540LCK8 | 3-117 | None |
| A0A1Y1I6E3 | 157-289 | None |
| A0A1D2A7Y8 | 115-249 | None |
| A0A7S4MRM9 | 98-253 | None |
| A0A080KIE1 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.