DPCstruct | MC415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 124 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438N349 | 1-113 | MKFVTISTIALALLSTSAEATVFLGTQGNWIIAWINGDNSCTQSVAISKKSENPCGRRFKLSNGFTYSLTGCGGSNFAVLNGDGSFN… |
| A0A1Y2WRP4 | 44-170 | MQFSIGSLAFLGIAAFTGFANAQAQAVAFGQQLQNDDQTNHWVAWVEGQHACPGMQVLDVLTKSPCDRAFNLGEVMYTFTGCSGDNG… |
| A0A409XRP4 | 129-255 | None |
| A0A409XP63 | 3-118 | None |
| A0A409XIR3 | 1-108 | None |
| A1CXE1 | 1-116 | None |
| C1HDL7 | 1-148 | None |
| A0A0D2PYD5 | 22-136 | None |
| A0A395T2B0 | 1-155 | None |
| A0A0U5FVG4 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.