DPCstruct | MC41498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 117 ± 9 aa |
| Standard deviation of domain lengths | 9.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4ZVR1 | 131-258 | DAVAWRRKYSQFLAKSALESLESEDERPESSVEPSKALEEPDDHVSREKFHPDVPVELESIIALNLLSVYEYAQRGNLKKMRARADS… |
| A0A117NST9 | 9-121 | RRSYAQLFAQAALTAVETETDDLSPASSTNVFERESCRAYSLHSQVPTQLHPVMALVVLGIYEYCQRGNISRMRARGNQAITTAMDI… |
| I8TIT6 | 3-107 | None |
| A1DJR4 | 17-128 | None |
| A0A3F3RKQ8 | 32-146 | None |
| X0IWX4 | 138-238 | None |
| A0A4Q7JJN8 | 192-312 | None |
| A6QZ18 | 36-156 | None |
| A0A4S3JSK1 | 1-132 | None |
| A0A6C1LRC8 | 251-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.