DPCstruct | MC41495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Standard deviation of domain lengths | 19.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101MPH5 | 1-160 | MNTPEQILDIEDALVSDENPARDEDTLDFQRCARWPAMAPDLDALASESWFFNQPNENIEAIRARLDPSLNSFLDLIYDPTPGFFYW… |
| A0A094BLQ2 | 387-534 | DELTWRATSEVPCRQVDGMDWERCAALHNLIVGLGWAVTGKPETEMPRVTWWQRHITDQALEDKWTTRLSPSLTLFLQAALETPPDQ… |
| A0A1Q5SS66 | 275-468 | None |
| A0A1B8FK43 | 1-138 | None |
| D4AZC7 | 7-186 | None |
| A0A4Q4M4K6 | 498-642 | None |
| A0A6A6GB98 | 40-202 | None |
| Q2H4R8 | 2-149 | None |
| A0A2V1DDX8 | 1-111 | None |
| A0A4Q4ZGP3 | 1-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.