DPCstruct | MC4149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Standard deviation of domain lengths | 5.57 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21006 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0WAH3 | 35-141 | SNAHFRAYTRAVHDVGGEPDVPIQWEEKEEEVWEHNTFITCEVLAWRGVWNAEERRRRQNVDVGQTQYLGLSYYGRWLLTAARILVD… |
| A0A7H4LST0 | 1-83 | MNGIHDLGGMHGLGPIPTEENEPYFHHEWERRVFPLFASLFVGGHFNVDEFRHAIERMAPTEYLQSSYYEHWLHAFETLLLAK |
| A0A535PYI6 | 1-88 | None |
| A0A2R6E8Q0 | 27-121 | None |
| A0A1X6YR41 | 2-82 | None |
| A0A7J9ZTT1 | 1-97 | None |
| A0A2R6I616 | 1-97 | None |
| A0A0M3GIC3 | 192-283 | None |
| A0A3R7TGB8 | 28-122 | None |
| A0A0L0M0V8 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.