DPCstruct | MC41488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 129 ± 16 aa |
| Standard deviation of domain lengths | 16.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8PJW0 | 11-136 | HHIESTSGDPQSHPSLAEEGATCKRKVPIVQSDLFICVGAVDVTKLLRGSRATLLEKAEFLGGNVLVDEYWTCTICGPKNRRNGTFR… |
| S7QN52 | 30-148 | VTRPQKRCRHCIKNNSGPARTHSALEGRLTTRNGRLVHRDTYLCSGAVDVEKLLYLSRRELYSIAQDCGGNVLLDEQWSYEICHPTF… |
| A0A284RAZ4 | 179-310 | None |
| M5FS46 | 11-122 | None |
| A0A5B1QTP9 | 187-321 | None |
| A0A146H0I5 | 99-216 | None |
| A0A401H2X3 | 469-602 | None |
| A0A5N5QMZ4 | 367-486 | None |
| A0A1Q3EQ14 | 321-435 | None |
| A0A0K6G4Y1 | 74-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.