DPCstruct | MC41483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 204 ± 26 aa |
| Standard deviation of domain lengths | 26.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.87 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060S7U5 | 20-218 | LVNLKDISEADARRIMSEEHRALGYRPPPGSLASQAQAVIARHESRRADEHALTLDEEQIRQAALADAERIKQQKEGSAEGSAEVDL… |
| S7Q041 | 1-216 | MTSSNASYLTEAALHESQPALKPKERLGEESDNNHSELVALHRDWQKTYLPQQRDETGLDADLLMSAERRALGQQPPLGSLADRAAV… |
| A0A5M3MDZ1 | 13-188 | None |
| A0A4Y9YNC7 | 15-205 | None |
| A0A4Q9NJ22 | 63-302 | None |
| F8QAB9 | 40-212 | None |
| A0A2G8RX60 | 50-287 | None |
| A0A4R0RAQ1 | 100-267 | None |
| A0A6A4HWB5 | 4-169 | None |
| A0A060S7T4 | 31-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.