DPCstruct | MC4148
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 140 ± 27 aa |
| Standard deviation of domain lengths | 27.41 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 28.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497B9T3 | 23-163 | LKAGCPKEVCIKCGRPKVRKYEVVQRKWEDLTKEEQDFLRRRYGLDKRGKYKGQSTKDFSGEDNPSNRKRRIVQSLLKTRRFVGWVP… |
| A0A660S3U7 | 2-125 | IKCACPQWICKKCGFIRERIIEKKLVVHKVFEDKRKAYQNVISGSKEMPAIPRARTGLEGHNEIYTIGWTDCGCNAGWESGIVLDPF… |
| A0A0F9R7P1 | 458-629 | None |
| A0A1I4JMJ9 | 275-466 | None |
| A0A832F115 | 2-129 | None |
| A0A0F9UN00 | 678-824 | None |
| A0A1F9VE18 | 235-342 | None |
| A0A6A7LSG5 | 156-272 | None |
| V6DPF2 | 364-550 | None |
| A0A7C5K8S6 | 4-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.