DPCstruct | MC41478
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 376 ± 38 aa |
| Standard deviation of domain lengths | 38.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 32.68 |
| Pfam Score | 95.24 |
| Assigned Pfam label(s) | CL0020- PF21638- PF05285 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9TM82 | 1-289 | MDATLLQDLTEYGKDKNKGVMMAARSLIGLFREINPELLKRKDRGKIASMNLKDFKPLQYGEVRAMERIEGIELLEEYKKQSSLGDD… |
| A0A7S1VB31 | 1-417 | YLGGHQRDVTAVLAYTVQACHEYVPPDEVYGLLKTIAHNFITERCSGEQMAVGINAARAICGRVPAVMSVEESNESTGATVMDIEGF… |
| A0A0L8I8S8 | 2-413 | None |
| X6MKJ1 | 120-476 | None |
| H0ENQ0 | 79-495 | None |
| A0A077YVM6 | 508-856 | None |
| A0A7R9H443 | 2-315 | None |
| A0A4U6XSS8 | 764-1159 | None |
| A0A124BVF8 | 554-941 | None |
| W9CHA8 | 355-731 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.