DPCstruct | MC41477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 175 ± 26 aa |
| Standard deviation of domain lengths | 26.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1DC87 | 30-182 | LAPLKPERDDYTICSSSKRVRFCNELSISPVLSLSDFSREERESYWFSARQYEIMRLATEITIRAMGSSRTWKDNDGFCSRGLEGRT… |
| A0A7S1UXH6 | 41-197 | KPAPKKKQVSFCEVVVFRTTISRHELSSNERSQYWFKKADFKKMRRDDKQTLDSLKKMPTAEKQDFCTRGLEKHIANGKVRYSVNVL… |
| A0A7S2I7D4 | 14-160 | None |
| A0A7S2IF98 | 1-159 | None |
| A0A448ZDN7 | 7-214 | None |
| A0A448ZEX3 | 114-286 | None |
| A0A448ZJF0 | 224-379 | None |
| A0A1E7EZ45 | 30-220 | None |
| A0A1E7EYZ9 | 3-173 | None |
| A0A1E7EZ75 | 73-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.