DPCstruct | MC41473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 147 ± 24 aa |
| Standard deviation of domain lengths | 24.33 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 36.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1GJ22 | 26-134 | KATIVIEHIIQASDVAHTMQHWRIFVRWNKRLFREMHRAYMDGRADRNPAEGWYENQLAFFDAYVIPLARKLKDCGVFGVSSDECLT… |
| A0A7S1UQ21 | 358-504 | SSSHGSAAASTGDESTLGSSMDDLDDEPDDLKATVVMEHLLRAADIGPNLQGWEHMKKWSGRLFYELKTSHEAGRCGFDPQEGWYEN… |
| A0A1E7FNG6 | 82-214 | None |
| K0RPS4 | 658-815 | None |
| A0A7S2EGW1 | 19-208 | None |
| A0A7S0F4P7 | 122-255 | None |
| A0A7R9ZSQ7 | 198-371 | None |
| A0A7R9ZP77 | 212-327 | None |
| A0A7R9WVL0 | 23-162 | None |
| A0A7R9WUR4 | 42-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.