DPCstruct | MC41472
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 424 ± 101 aa |
| Standard deviation of domain lengths | 100.91 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0489 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1UNI9 | 70-539 | APIPAGGQLILNTMDEEAYALTPADRKKLVATVEHTQHMINDQTPDVVRDLIRFIRGTLDPPLRDYFPANVEQLKRANEVGVDEAWR… |
| A0A1Z5KLN7 | 219-531 | VHTPEWVRKHGMCIDHIEIRQALDPEMGRGAFARRFLPRGSVVAPAPLQTFKNRNDFAQQEPEALFVNYCFQPSGTNILLFPYGPGV… |
| A0A7S0KYB4 | 1-381 | None |
| A0A7S1GRS0 | 92-536 | None |
| A0A7S1ZFG5 | 112-611 | None |
| A0A7S0Y861 | 1-385 | None |
| A0A7S0ULC9 | 148-651 | None |
| B7FU17 | 716-1204 | None |
| A0A7S2PKZ4 | 100-556 | None |
| A0A7S2UP20 | 51-500 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.